Teriparatide Peptides 10mg 10vials 1kits
Original price was: $520.00.$260.00Current price is: $260.00.
Teriparatide Peptides for research use.
100% delivery
- Satisfaction Guaranteed
- No Hassle Refunds
- Secure Payments
Description
High purity Teriparatide Research Peptide
Product Profile
Teriparatide is a synthetic polypeptide fragment containing the identical 34 N-terminal amino acids of endogenous human parathyroid hormone. [Teriparatide agonizes the transmembrane PTH1R system]. This ultra-pure lyophilizate serves as a primary research benchmark for exploring microstructural bone remodeling architecture, osteoblastogenesis kinetics, and localized mechanical loading adaptation paths by activating critical downstream bone matrix deposition networks without triggering systemic catabolic breakdown. Its truncated design isolates the active signaling domain. This allows for clean metabolic analysis without peripheral interference.
Specification Sheet
- Amino Acid Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- CAS Number: 52232-67-4
- Molecular Formula: C181H291N55O51S2
- Molecular Weight: 4117.8 g/mol
- Purity: >99.0% via HPLC-UV and Mass Spectrometry validation
- Appearance: Sterile white lyophilized powder cake
Pharmacodynamics
The biochemical activity of Teriparatide depends entirely on its pulsatile concentration profile rather than sustained continuous exposure matrices. The primary mechanism involves the open linear peptide chain binds selectively to the G-protein coupled parathyroid hormone 1 receptor (PTH1R) on osteoblast membranes. This defines the first semantic triple: [Teriparatide binds to transmembrane PTH1R]. Additionally, this specific binding configuration activates the stimulatory G-protein subunit, directly triggering adenylate cyclase enzymes to accumulate intracellular cyclic AMP (cAMP). This establishes the second triple: [Receptor activation stimulates adenylate cyclase cascades]. Finally, this acute downstream intracellular signaling upregulates osteoblast differentiation factors while suppressing mature osteoblast apoptosis pathways. This forms the third triple: [Downstream intracellular signaling upregulates osteoblast differentiation]. Quantitatively, Teriparatide possesses a brief systemic biological half-life of approximately 1.0 hour ($t_{1/2} = 1.0 pm 0.2$ h) following subcutaneous administration in mammalian models, matching its tight target receptor binding affinity ($K_D approx 2.0$ nM). In comparative studies, Teriparatide is strictly distinguished from full-length human PTH(1-84); while the intact hormone has a longer systemic persistence that frequently favors catabolic osteoclast-mediated bone resorption, the truncated 1-34 variant preserves a transient, distinct anabolic window when applied intermittently.
Known Effects
- Enhanced Osteoblast Differentiation: Users in research models report a rapid acceleration of osteoblast precursor recruitment, leading to dense mineralized matrix deposition.
- Microstructural Architecture Reinforcement: Published research indicates profound improvements in trabecular bone connectivity and cortical shell thickness profiles.
- Optimized Mineral Partitioning: According to research documentation, research models demonstrate balanced localized calcium and phosphate shifts without inducing systemic adjustments when managed properly.
- Accelerated Skeletal Remodeling: Aggregated data shows noticeability in bone turnover velocity, shortening structural recovery phases following localized stress tests.
- Suppression of Osteoblast Apoptosis: Research models have observed a major down-regulation of programmed cell death pathways within active bone-forming cell lines.
In Brief:
Teriparatide represents an absolute benchmark research tool for investigating intermittent parathyroid signaling pathways, osteoblast survival mechanics, and the molecular cascades of skeletal remodeling.
Frequently Asked Questions
What is the biological half-life of Teriparatide?
Teriparatide has a brief biological half-life of approximately 1.0 hour post-subcutaneous injection, which is essential to preserve its anabolic signaling window.
How should reconstituted Teriparatide be stored?
Once reconstituted, the solution must be continuously refrigerated at 2-8 degrees Celsius and used within 28 days to prevent peptide degradation.
How does Teriparatide differ from full-length PTH?
Teriparatide is a truncated 1-34 fragment optimized for intermittent anabolic bone formation, whereas full-length PTH(1-84) has a greater propensity for catabolic bone resorption.
What is the typical research dosage used?
Experienced researchers typically utilize 20mcg to 40mcg daily via subcutaneous micro-injection, starting conservatively to track baseline calcemic responses accurately.
Does Teriparatide cause androgenic or HPTA suppression?
No, Teriparatide is a non-hormonal polypeptide hormone fragment that operates via parathyroid receptors and does not interact with or suppress endocrine axes.
These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. Consult a qualified healthcare professional before use.
You must be logged in to post a review.
Reviews
There are no reviews yet.