Teriparatide Peptides 10mg 10vials 1kits

Description

High purity Teriparatide Research Peptide

Product Profile

Teriparatide is a synthetic polypeptide fragment containing the identical 34 N-terminal amino acids of endogenous human parathyroid hormone. [Teriparatide agonizes the transmembrane PTH1R system]. This ultra-pure lyophilizate serves as a primary research benchmark for exploring microstructural bone remodeling architecture, osteoblastogenesis kinetics, and localized mechanical loading adaptation paths by activating critical downstream bone matrix deposition networks without triggering systemic catabolic breakdown. Its truncated design isolates the active signaling domain. This allows for clean metabolic analysis without peripheral interference.

Specification Sheet

• Amino Acid Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
• CAS Number: 52232-67-4
• Molecular Formula: C181H291N55O51S2
• Molecular Weight: 4117.8 g/mol
• Purity: >99.0% via HPLC-UV and Mass Spectrometry validation
• Appearance: Sterile white lyophilized powder cake

Pharmacodynamics

The biochemical activity of Teriparatide depends entirely on its pulsatile concentration profile rather than sustained continuous exposure matrices. The primary mechanism involves the open linear peptide chain binds selectively to the G-protein coupled parathyroid hormone 1 receptor (PTH1R) on osteoblast membranes. This defines the first semantic triple: [Teriparatide binds to transmembrane PTH1R]. Additionally, this specific binding configuration activates the stimulatory G-protein subunit, directly triggering adenylate cyclase enzymes to accumulate intracellular cyclic AMP (cAMP). This establishes the second triple: [Receptor activation stimulates adenylate cyclase cascades]. Finally, this acute downstream intracellular signaling upregulates osteoblast differentiation factors while suppressing mature osteoblast apoptosis pathways. This forms the third triple: [Downstream intracellular signaling upregulates osteoblast differentiation]. Quantitatively, Teriparatide possesses a brief systemic biological half-life of approximately 1.0 hour ($t_{1/2} = 1.0 pm 0.2$ h) following subcutaneous administration in mammalian models, matching its tight target receptor binding affinity ($K_D approx 2.0$ nM). In comparative studies, Teriparatide is strictly distinguished from full-length human PTH(1-84); while the intact hormone has a longer systemic persistence that frequently favors catabolic osteoclast-mediated bone resorption, the truncated 1-34 variant preserves a transient, distinct anabolic window when applied intermittently.

Known Effects

• Enhanced Osteoblast Differentiation: Users in research models report a rapid acceleration of osteoblast precursor recruitment, leading to dense mineralized matrix deposition.
• Microstructural Architecture Reinforcement: Published research indicates profound improvements in trabecular bone connectivity and cortical shell thickness profiles.
• Optimized Mineral Partitioning: According to research documentation, research models demonstrate balanced localized calcium and phosphate shifts without inducing systemic adjustments when managed properly.
• Accelerated Skeletal Remodeling: Aggregated data shows noticeability in bone turnover velocity, shortening structural recovery phases following localized stress tests.
• Suppression of Osteoblast Apoptosis: Research models have observed a major down-regulation of programmed cell death pathways within active bone-forming cell lines.

In Brief:
Teriparatide represents an absolute benchmark research tool for investigating intermittent parathyroid signaling pathways, osteoblast survival mechanics, and the molecular cascades of skeletal remodeling.

Frequently Asked Questions

These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. Consult a qualified healthcare professional before use.